PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00358g00058.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 458aa    MW: 49773.7 Da    PI: 7.2783
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00358g00058.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.5e-164387147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              r +WT+eE++++v+a k++G   W  I +++g ++t+ q++s+ qk+
  Peaxi162Scf00358g00058.1 43 REKWTEEEHKRFVEALKLYGRA-WGQIEEHVG-TKTAIQIRSHAQKF 87
                              789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.18E-163791IPR009057Homeodomain-like
PROSITE profilePS5129419.8323892IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-83988IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-164190IPR006447Myb domain, plants
SMARTSM007172.9E-124290IPR001005SANT/Myb domain
PfamPF002498.6E-134386IPR001005SANT/Myb domain
CDDcd001672.75E-94588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MDHASSVISS KVETVATQPR AVTSPRNENI PKVRKPYTIR KQREKWTEEE HKRFVEALKL  60
YGRAWGQIEE HVGTKTAIQI RSHAQKFFAK VARDSDNNGD GSLNVMDIPP PRPKKKPLHP  120
YPRKMVDSPI TDQGNSAQPE KSPFPNASPK GRDTCSPVSV LLASDSDLFE PSVAKRKSAH  180
FAPASCTLDA HSGTISRGND DDCLTANSTI EEEVLVTKVV ADSCCPVANP TTKCNMVSKD  240
TSCSGEKLAV EAPVASIKLF GQTVFVPDAP NLDSESPENC SSSLSSASVD ENKKSNENLL  300
PSFPSNQANT QFVLPMVPGS MIAPPCLSPQ NILDDNSTNI ASLAATMSWC SWYQDLLYRY  360
ISSCTQTVMG SYAPCQGQNS EEPQREGSSS GSNIGSTSEV DDGKRNCDAV ESKCTSRSEK  420
QGCTKGFIPY KRCLAERDGN LSGAIAEKRR EQRARVCS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1518049e-32AC151804.1 Solanum demissum chromosome 5 clone PGEC475B22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015071308.11e-171PREDICTED: histone H2A deubiquitinase MYSM1-like isoform X2
TrEMBLK4BJP71e-168K4BJP7_SOLLC; Uncharacterized protein
STRINGSolyc03g098320.2.11e-167(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.19e-36MYB_related family protein